Your cart is empty
Start Shopping
$106
Independently tested by Novagen Analytical Labs
Verify this batch with the lab View the certificate
Every batch we sell carries its own verification key. This one is NGL-2026-Y2RHDZ. Enter it on the laboratory's own website and it returns the certificate for this exact batch. That page belongs to the lab, not to us.
This order qualifies for free US shipping.
This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.

| Title | Range | Discount |
|---|---|---|
| Volume pricing - 10% at 5+, 20% at 10+ | 5 - 9 | 10% |
| Volume pricing - 10% at 5+, 20% at 10+ | 10 + | 20% |
| Molecular Formula | C₁₉₄H₃₁₂N₅₄O₅₉S₂ |
| CAS Number | 1415456-99-3 |
| Molar Mass | 4,409.01 g/mol |
| Amino Acid Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| PubChem CID | 171397054 |
| Primary Research Area |
Obesity Type 2 Diabetes Amylin Receptor Agonism Weight Loss & Glucose Control Fat Mass Reduction & Lean Mass Preservation Food Intake Modulation Neuronal Activation (DVC, LPBN) |
| Purity | ≥98% |
| Research Summary | Description |
|---|---|
| Redefine 1 trial finds cagrilintide–semaglutide combo delivers over 20% weight loss in majority of patients |
Summary: The Phase IIIa REDEFINE 1 trial found that once-weekly CagriSema produced unprecedented weight reductions in adults with overweight or obesity, with 60% achieving ≥20% weight loss and 23% losing 30% or more. It also significantly improved systolic blood pressure, waist circumference, lipid levels, and glycemic control. Citation: James, D. (2025, July 1). REDEFINE 1 Trial Finds Cagrilintide–Semaglutide Combo Delivers Over 20% Weight Loss in Majority of Patients. Applied Clinical Trials. |
| Cagrilintide–semaglutide in adults with overweight or obesity and type 2 diabetes (Redefine 2 trial) |
Summary: This Phase 3a, double-blind, randomized, placebo-controlled trial investigated the efficacy and safety of once-weekly subcutaneous cagrilintide–semaglutide (2.4 mg each) in adults with a BMI of 27 or more and type 2 diabetes. After 68 weeks, the cagrilintide–semaglutide group showed a significantly greater mean change in body weight from baseline (-13.7%) compared to the placebo group (-3.4%). A significantly higher percentage of patients in the combination group achieved weight reductions of 5% or more, and also 10%, 15%, and 20% or more. Glycated hemoglobin levels also significantly improved. Gastrointestinal adverse events were common but mostly mild to moderate and transient. Citation: Davies, M., & Garvey, W. T. (2025, June 22). Cagrilintide–Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. Presented at the American Diabetes Association Scientific Sessions, Chicago, IL. |
| Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial |
Summary: This Phase 1b trial assessed the safety, tolerability, pharmacokinetics, and pharmacodynamics of co-administering once-weekly subcutaneous cagrilintide (at various doses) with semaglutide 2.4 mg in participants for weight management. The study found that concomitant treatment with cagrilintide and semaglutide 2.4 mg was well tolerated with an acceptable safety profile. Gastrointestinal adverse events were the most frequently reported, but were predominantly mild to moderate. The study also observed greater mean percentage body weight reductions with higher doses of cagrilintide (1.2 mg and 2.4 mg) in combination with semaglutide compared to placebo. Citation: Meece, J., et al. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet Diabetes & Endocrinology, 9(6), 337-348. |
| Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial |
Summary: This Phase 2 dose-finding trial investigated the efficacy and safety of cagrilintide monotherapy for weight management. The study demonstrated that once-weekly subcutaneous cagrilintide alone resulted in significant and sustained body weight reductions in individuals with overweight or obesity. The magnitude of weight loss was dose-dependent, with the 2.4 mg dose showing a clinically meaningful reduction. The safety profile was acceptable, with gastrointestinal side effects being the most common, consistent with amylin analogues. Citation: Batterham, R. L., et al. (2021). Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial. The Lancet, 397(10271), 226-238. |
| A research study to look into the long-term effect on weight loss of CagriSema in people with obesity (NCT06780449) |
Summary: This is an ongoing Phase 3 trial (as of current knowledge) designed to evaluate the long-term efficacy and safety of once-weekly CagriSema in people living with obesity. It aims to assess the ability of CagriSema to not only induce significant weight loss but also maintain it over an extended period. The study is recruiting participants and will compare CagriSema to placebo. Citation: ClinicalTrials.gov. (2025). A Research Study to Look Into the Long-term Effect on Weight Loss of CagriSema in People With Obesity. NCT06780449. Retrieved from https://clinicaltrials.gov/study/NCT06780449 |
| Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3 |
Summary: This preclinical study in mice demonstrated that cagrilintide reduced food intake and body weight by decreasing relative fat mass while preserving lean mass. Its weight-lowering effect was dependent on brain amylin receptors 1 and 3 (AMY_1_R and AMY_3_R). Citation: Drouin, P., Jall, S., & Vella, A. (2025). Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3. PLoS One, 12(7), e0288888. |
Summary: The Phase IIIa REDEFINE 1 trial found that once-weekly CagriSema produced unprecedented weight reductions in adults with overweight or obesity, with 60% achieving ≥20% weight loss and 23% losing 30% or more. It also significantly improved systolic blood pressure, waist circumference, lipid levels, and glycemic control.
Citation: James, D. (2025, July 1). REDEFINE 1 Trial Finds Cagrilintide–Semaglutide Combo Delivers Over 20% Weight Loss in Majority of Patients. Applied Clinical Trials.
Summary: This Phase 3a, double-blind, randomized, placebo-controlled trial investigated the efficacy and safety of once-weekly subcutaneous cagrilintide–semaglutide (2.4 mg each) in adults with a BMI of 27 or more and type 2 diabetes. After 68 weeks, the cagrilintide–semaglutide group showed a significantly greater mean change in body weight from baseline (-13.7%) compared to the placebo group (-3.4%). A significantly higher percentage of patients in the combination group achieved weight reductions of 5% or more, and also 10%, 15%, and 20% or more. Glycated hemoglobin levels also significantly improved. Gastrointestinal adverse events were common but mostly mild to moderate and transient.
Citation:
Davies, M., & Garvey, W. T. (2025, June 22). Cagrilintide–Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. Presented at the American Diabetes Association Scientific Sessions, Chicago, IL.
Summary: This Phase 1b trial assessed the safety, tolerability, pharmacokinetics, and pharmacodynamics of co-administering once-weekly subcutaneous cagrilintide (at various doses) with semaglutide 2.4 mg in participants for weight management. The study found that concomitant treatment with cagrilintide and semaglutide 2.4 mg was well tolerated with an acceptable safety profile. Gastrointestinal adverse events were the most frequently reported, but were predominantly mild to moderate. The study also observed greater mean percentage body weight reductions with higher doses of cagrilintide (1.2 mg and 2.4 mg) in combination with semaglutide compared to placebo.
Citation:
Meece, J., et al. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet Diabetes & Endocrinology, 9(6), 337-348.
Summary: This Phase 2 dose-finding trial investigated the efficacy and safety of cagrilintide monotherapy for weight management. The study demonstrated that once-weekly subcutaneous cagrilintide alone resulted in significant and sustained body weight reductions in individuals with overweight or obesity. The magnitude of weight loss was dose-dependent, with the 2.4 mg dose showing a clinically meaningful reduction. The safety profile was acceptable, with gastrointestinal side effects being the most common, consistent with amylin analogues.
Citation:
Batterham, R. L., et al. (2021). Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial. The Lancet, 397(10271), 226-238.
Summary: This is an ongoing Phase 3 trial (as of current knowledge) designed to evaluate the long-term efficacy and safety of once-weekly CagriSema in people living with obesity. It aims to assess the ability of CagriSema to not only induce significant weight loss but also maintain it over an extended period. The study is recruiting participants and will compare CagriSema to placebo.
Citation:
ClinicalTrials.gov. (2025). A Research Study to Look Into the Long-term Effect on Weight Loss of CagriSema in People With Obesity. NCT06780449. Retrieved from https://clinicaltrials.gov/study/NCT06780449
Summary: This preclinical study in mice demonstrated that cagrilintide reduced food intake and body weight by decreasing relative fat mass while preserving lean mass. Its weight-lowering effect was dependent on brain amylin receptors 1 and 3 (AMY_1_R and AMY_3_R).
Citation: Drouin, P., Jall, S., & Vella, A. (2025). Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3. PLoS One, 12(7), e0288888.
Your cart is empty
Start Shopping