Free US shipping for orders above $200 • Free international shipping for orders above $350 • Subscribe to receive 10% off

Cagrilintide 10mg

Cagrilintide 10mg

$145.00

Cagrilintide 10mg is a high-purity synthetic peptide analog of the pancreatic hormone amylin, designed for research on metabolic regulation and energy balance. As a dual amylin and calcitonin receptor agonist, it is being studied for its role in glucose control, appetite modulation, and weight regulation pathways. Cagrilintide has gained significant interest in metabolic and endocrine research due to its dual receptor activity. Studies are exploring: Its effects on amylin and calcitonin receptor signaling, Synergistic outcomes when co-administered with GLP-1 receptor agonists like Semaglutide (the “CagriSema” combination), Its influence on energy expenditure and appetite pathways, Potential mechanisms in glucose homeostasis and lipid metabolism.

This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.

In Stock

Data Sheet

Molecular Formula C₁₉₄H₃₁₂N₅₄O₅₉S₂
CAS Number 1415456-99-3
Molar Mass 4,409.01 g/mol
Amino Acid Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
PubChem CID 171397054
Primary Research Area Obesity
Type 2 Diabetes
Amylin Receptor Agonism
Weight Loss & Glucose Control
Fat Mass Reduction & Lean Mass Preservation
Food Intake Modulation
Neuronal Activation (DVC, LPBN)
Purity >99%
Research Summary Description
Redefine 1 trial finds cagrilintide–semaglutide combo delivers over 20% weight loss in majority of patients Summary: The Phase IIIa REDEFINE 1 trial found that once-weekly CagriSema produced unprecedented weight reductions in adults with overweight or obesity, with 60% achieving ≥20% weight loss and 23% losing 30% or more. It also significantly improved systolic blood pressure, waist circumference, lipid levels, and glycemic control.

Citation: James, D. (2025, July 1). REDEFINE 1 Trial Finds Cagrilintide–Semaglutide Combo Delivers Over 20% Weight Loss in Majority of Patients. Applied Clinical Trials.
Cagrilintide–semaglutide in adults with overweight or obesity and type 2 diabetes (Redefine 2 trial) Summary: This Phase 3a, double-blind, randomized, placebo-controlled trial investigated the efficacy and safety of once-weekly subcutaneous cagrilintide–semaglutide (2.4 mg each) in adults with a BMI of 27 or more and type 2 diabetes. After 68 weeks, the cagrilintide–semaglutide group showed a significantly greater mean change in body weight from baseline (-13.7%) compared to the placebo group (-3.4%). A significantly higher percentage of patients in the combination group achieved weight reductions of 5% or more, and also 10%, 15%, and 20% or more. Glycated hemoglobin levels also significantly improved. Gastrointestinal adverse events were common but mostly mild to moderate and transient.

Citation:
Davies, M., & Garvey, W. T. (2025, June 22). Cagrilintide–Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. Presented at the American Diabetes Association Scientific Sessions, Chicago, IL.
Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial Summary: This Phase 1b trial assessed the safety, tolerability, pharmacokinetics, and pharmacodynamics of co-administering once-weekly subcutaneous cagrilintide (at various doses) with semaglutide 2.4 mg in participants for weight management. The study found that concomitant treatment with cagrilintide and semaglutide 2.4 mg was well tolerated with an acceptable safety profile. Gastrointestinal adverse events were the most frequently reported, but were predominantly mild to moderate. The study also observed greater mean percentage body weight reductions with higher doses of cagrilintide (1.2 mg and 2.4 mg) in combination with semaglutide compared to placebo.

Citation:
Meece, J., et al. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet Diabetes & Endocrinology, 9(6), 337-348.
Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial Summary: This Phase 2 dose-finding trial investigated the efficacy and safety of cagrilintide monotherapy for weight management. The study demonstrated that once-weekly subcutaneous cagrilintide alone resulted in significant and sustained body weight reductions in individuals with overweight or obesity. The magnitude of weight loss was dose-dependent, with the 2.4 mg dose showing a clinically meaningful reduction. The safety profile was acceptable, with gastrointestinal side effects being the most common, consistent with amylin analogues.

Citation:
Batterham, R. L., et al. (2021). Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial. The Lancet, 397(10271), 226-238.
A research study to look into the long-term effect on weight loss of CagriSema in people with obesity (NCT06780449) Summary: This is an ongoing Phase 3 trial (as of current knowledge) designed to evaluate the long-term efficacy and safety of once-weekly CagriSema in people living with obesity. It aims to assess the ability of CagriSema to not only induce significant weight loss but also maintain it over an extended period. The study is recruiting participants and will compare CagriSema to placebo.

Citation:
ClinicalTrials.gov. (2025). A Research Study to Look Into the Long-term Effect on Weight Loss of CagriSema in People With Obesity. NCT06780449. Retrieved from https://clinicaltrials.gov/study/NCT06780449
Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3 Summary: This preclinical study in mice demonstrated that cagrilintide reduced food intake and body weight by decreasing relative fat mass while preserving lean mass. Its weight-lowering effect was dependent on brain amylin receptors 1 and 3 (AMY_1_R and AMY_3_R).

Citation: Drouin, P., Jall, S., & Vella, A. (2025). Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3. PLoS One, 12(7), e0288888.

Redefine 1 trial finds cagrilintide–semaglutide combo delivers over 20% weight loss in majority of patients

Summary: The Phase IIIa REDEFINE 1 trial found that once-weekly CagriSema produced unprecedented weight reductions in adults with overweight or obesity, with 60% achieving ≥20% weight loss and 23% losing 30% or more. It also significantly improved systolic blood pressure, waist circumference, lipid levels, and glycemic control.

Citation: James, D. (2025, July 1). REDEFINE 1 Trial Finds Cagrilintide–Semaglutide Combo Delivers Over 20% Weight Loss in Majority of Patients. Applied Clinical Trials.

Cagrilintide–semaglutide in adults with overweight or obesity and type 2 diabetes (Redefine 2 trial)

Summary: This Phase 3a, double-blind, randomized, placebo-controlled trial investigated the efficacy and safety of once-weekly subcutaneous cagrilintide–semaglutide (2.4 mg each) in adults with a BMI of 27 or more and type 2 diabetes. After 68 weeks, the cagrilintide–semaglutide group showed a significantly greater mean change in body weight from baseline (-13.7%) compared to the placebo group (-3.4%). A significantly higher percentage of patients in the combination group achieved weight reductions of 5% or more, and also 10%, 15%, and 20% or more. Glycated hemoglobin levels also significantly improved. Gastrointestinal adverse events were common but mostly mild to moderate and transient.

Citation:
Davies, M., & Garvey, W. T. (2025, June 22). Cagrilintide–Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. Presented at the American Diabetes Association Scientific Sessions, Chicago, IL.

Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial

Summary: This Phase 1b trial assessed the safety, tolerability, pharmacokinetics, and pharmacodynamics of co-administering once-weekly subcutaneous cagrilintide (at various doses) with semaglutide 2.4 mg in participants for weight management. The study found that concomitant treatment with cagrilintide and semaglutide 2.4 mg was well tolerated with an acceptable safety profile. Gastrointestinal adverse events were the most frequently reported, but were predominantly mild to moderate. The study also observed greater mean percentage body weight reductions with higher doses of cagrilintide (1.2 mg and 2.4 mg) in combination with semaglutide compared to placebo.

Citation:
Meece, J., et al. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet Diabetes & Endocrinology, 9(6), 337-348.

Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial

Summary: This Phase 2 dose-finding trial investigated the efficacy and safety of cagrilintide monotherapy for weight management. The study demonstrated that once-weekly subcutaneous cagrilintide alone resulted in significant and sustained body weight reductions in individuals with overweight or obesity. The magnitude of weight loss was dose-dependent, with the 2.4 mg dose showing a clinically meaningful reduction. The safety profile was acceptable, with gastrointestinal side effects being the most common, consistent with amylin analogues.

Citation:
Batterham, R. L., et al. (2021). Efficacy and safety of once-weekly cagrilintide for weight management: a randomised, placebo and active-controlled, dose-finding phase 2 trial. The Lancet, 397(10271), 226-238.

A research study to look into the long-term effect on weight loss of CagriSema in people with obesity (NCT06780449)

Summary: This is an ongoing Phase 3 trial (as of current knowledge) designed to evaluate the long-term efficacy and safety of once-weekly CagriSema in people living with obesity. It aims to assess the ability of CagriSema to not only induce significant weight loss but also maintain it over an extended period. The study is recruiting participants and will compare CagriSema to placebo.

Citation:
ClinicalTrials.gov. (2025). A Research Study to Look Into the Long-term Effect on Weight Loss of CagriSema in People With Obesity. NCT06780449. Retrieved from https://clinicaltrials.gov/study/NCT06780449

Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3

Summary: This preclinical study in mice demonstrated that cagrilintide reduced food intake and body weight by decreasing relative fat mass while preserving lean mass. Its weight-lowering effect was dependent on brain amylin receptors 1 and 3 (AMY_1_R and AMY_3_R).

Citation: Drouin, P., Jall, S., & Vella, A. (2025). Cagrilintide lowers bodyweight through brain amylin receptors 1 and 3. PLoS One, 12(7), e0288888.

All content and product details on this website are provided solely for informational and educational purposes.

View Cart (0 items)

Your cart is empty

Start Shopping